svn commit: r1792130 [1/3] - in /tomcat/tc8.5.x/trunk: ./ java/org/apache/jasper/resources/

Previous Topic Next Topic
classic Classic list List threaded Threaded
1 message Options
Reply | Threaded
Open this post in threaded view
Report Content as Inappropriate

svn commit: r1792130 [1/3] - in /tomcat/tc8.5.x/trunk: ./ java/org/apache/jasper/resources/

Author: markt
Date: Thu Apr 20 19:11:23 2017
New Revision: 1792130

Add [...] delimiters to values in messages that don't currently have them for org.apache.jasper packages

    tomcat/tc8.5.x/trunk/   (props changed)

Propchange: tomcat/tc8.5.x/trunk/
--- svn:mergeinfo (original)
+++ svn:mergeinfo Thu Apr 20 19:11:23 2017
@@ -1 +1 @@

Modified: tomcat/tc8.5.x/trunk/java/org/apache/jasper/resources/
--- tomcat/tc8.5.x/trunk/java/org/apache/jasper/resources/ (original)
+++ tomcat/tc8.5.x/trunk/java/org/apache/jasper/resources/ Thu Apr 20 19:11:23 2017
@@ -20,65 +20,65 @@ jsp.error.compiler=No Java compiler avai JSP engine is not configured with a scratch dir.\
 \n Please add "jsp.initparams=scratchdir=<dir-name>" \
 \n in the file for this context.
-jsp.error.bad.scratch.dir=The scratchDir you specified: {0} is unusable. dir for the JSP engine is: {0}
-jsp.message.parent_class_loader_is=Parent class loader is: {0}
+jsp.error.bad.scratch.dir=The scratchDir you specified: [{0}] is unusable. dir for the JSP engine is: [{0}]
+jsp.message.parent_class_loader_is=Parent class loader is: [{0}]
 jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets
 jsp.error.unavailable=JSP has been marked unavailable
-jsp.error.usebean.duplicate=useBean: Duplicate bean name: {0}
-jsp.error.invalid.scope=Illegal value of ''scope'' attribute: {0} (must be one of "page", "request", "session", or "application")
+jsp.error.usebean.duplicate=useBean: Duplicate bean name: [{0}]
+jsp.error.invalid.scope=Illegal value of ''scope'' attribute: [{0}] (must be one of "page", "request", "session", or "application")
 jsp.error.classname=Can't determine classname from .class file
 jsp.error.outputfolder=No output folder while writing data file directive: illegal to have multiple occurrences of ''contentType'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''session'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''contentType'' with different values (old: [{0}], new: [{1}]) directive: illegal to have multiple occurrences of ''session'' with different values (old: [{0}], new: [{1}]) directive: invalid value for session directive: illegal to have multiple occurrences of ''buffer'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''buffer'' with different values (old: [{0}], new: [{1}]) directive: invalid value for buffer directive: illegal to have multiple occurrences of ''autoFlush'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''autoFlush'' with different values (old: [{0}], new: [{1}]) directive: invalid value for import directive: illegal to have multiple occurrences of ''isThreadSafe'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''isThreadSafe'' with different values (old: [{0}], new: [{1}]) directive: invalid value for isThreadSafe directive: illegal to have multiple occurrences of ''info'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''info'' with different values (old: [{0}], new: [{1}]) directive: invalid value for info directive: illegal to have multiple occurrences of ''isErrorPage'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''isErrorPage'' with different values (old: [{0}], new: [{1}]) directive: invalid value for isErrorPage directive: illegal to have multiple occurrences of ''errorPage'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''language'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of ''language'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''errorPage'' with different values (old: [{0}], new: [{1}]) directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of ''language'' with different values (old: [{0}], new: [{1}]) directive: invalid language attribute
 jsp.error.tag.language.nonjava=Tag directive: invalid language attribute directive: illegal to have multiple occurrences of ''extends'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''extends'' with different values (old: [{0}], new: [{1}]) directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of ''isELIgnored'' with different values (old: [{0}], new: [{1}]) directive: invalid value for isELIgnored
 jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored directive must not have multiple occurrences of pageencoding
-jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute [{0}] with different values (old: {1}, new: {2})
+jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute [{0}] with different values (old: [{1}], new: [{2}])
 jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of pageencoding
-jsp.error.include.exception=Unable to include {0}
+jsp.error.include.exception=Unable to include [{0}] to close stream closed
 jsp.error.invalid.directive=Invalid directive
-jsp.error.invalid.implicit=Invalid implicit TLD for tag file at {0}
-jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at {0}
-jsp.error.invalid.version=Invalid JSP version defined for tag file at {0}
-jsp.error.directive.istagfile={0} directive cannot be used in a tag file
-jsp.error.directive.isnottagfile={0} directive can only be used in a tag file
-jsp.error.action.istagfile={0} action cannot be used in a tag file
-jsp.error.action.isnottagfile={0} action can be used in tag files only
-jsp.error.unterminated=Unterminated {0} tag
+jsp.error.invalid.implicit=Invalid implicit TLD for tag file at [{0}]
+jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at [{0}]
+jsp.error.invalid.version=Invalid JSP version defined for tag file at [{0}]
+jsp.error.directive.istagfile=[{0}] directive cannot be used in a tag file
+jsp.error.directive.isnottagfile=[{0}] directive can only be used in a tag file
+jsp.error.action.istagfile=[{0}] action cannot be used in a tag file
+jsp.error.action.isnottagfile=[{0}] action can be used in tag files only
+jsp.error.unterminated=Unterminated [{0}] tag
 jsp.error.loadclass.taghandler=Unable to load tag handler class [{0}] for tag [{1}]
 jsp.error.unable.compile=Unable to compile class for JSP
 jsp.error.unable.load=Unable to load class for JSP
-jsp.error.mandatory.attribute={0}: Mandatory attribute {1} missing
+jsp.error.mandatory.attribute=[{0}]: Mandatory attribute [{1}] missing
 jsp.error.flush=Exception occurred when flushing data JSP 2.3 Engine
-jsp.error.invalid.expression=[{0}] contains invalid expression(s): {1}
-jsp.error.invalid.attribute={0} has invalid attribute: {1} read file: {0}
-jsp.error.file.already.registered=Recursive include of file {0}
-jsp.error.file.not.registered=file {0} not seen in include
+jsp.error.invalid.expression=[{0}] contains invalid expression(s): [{1}]
+jsp.error.invalid.attribute=[{0}] has invalid attribute: [{1}] read file: [{0}]
+jsp.error.file.already.registered=Recursive include of file [{0}]
+jsp.error.file.not.registered=file [{0}] not seen in include
 jsp.error.quotes.unterminated=Unterminated quotes
 jsp.error.attr.quoted=Attribute value should be quoted
 jsp.error.beans.nullbean=Attempted a bean operation on a null object.
@@ -86,7 +86,7 @@ jsp.error.beans.nobeaninfo=No BeanInfo f
 jsp.error.beans.nomethod=Cannot find a method to read property [{0}] in a bean of type [{1}]
 jsp.error.beans.nomethod.setproperty=Can''t find a method to write property [{0}] of type [{1}] in a bean of type [{2}]
 jsp.error.beans.noproperty=Cannot find any information on property [{0}] in a bean of type [{1}] to convert string [{0}] to class [{1}] for attribute [{2}]: {3} to convert string [{0}] to class [{1}] for attribute [{2}]: [{3}]
 jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the PropertyEditorManager
 jsp.error.beans.setproperty.noindexset=Cannot set indexed property
 jsp.error.include.tag=Invalid jsp:include tag
@@ -105,7 +105,7 @@ jsp.error.plugin.nocode=code not declare
 jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0
 jsp.error.javac=Javac exception
-jsp.error.compilation=Error compiling file: {0} {1}
+jsp.error.compilation=Error compiling file: [{0}] [{1}]
 jsp.error.undeclared_namespace=A custom tag was encountered with an undeclared namespace [{0}]
 jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the default value of "false"
 jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the default value of "false"
@@ -133,17 +133,17 @@ element [{0}] in validator element [{0}] in validator''s init-param element [{0}] in function
-jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: {0}
-jsp.error.non_null_tei_and_var_subelems=Tag {0} has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo Error in the tag library descriptor: {0}
+jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: [{0}]
+jsp.error.non_null_tei_and_var_subelems=Tag [{0}] has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo Error in the tag library descriptor: [{0}]
 jsp.error.file.not.found=File [{0}] not found
-jsp.error.missing_attribute=According to the TLD or the tag file, attribute {0} is mandatory for tag {1}
-jsp.error.bad_attribute=Attribute {0} invalid for tag {1} according to TLD
-jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing TLD: {1}
-jsp.error.tld.missing=Unable to find taglib [{0}] for URI: {1}
+jsp.error.missing_attribute=According to the TLD or the tag file, attribute [{0}] is mandatory for tag [{1}]
+jsp.error.bad_attribute=Attribute [{0}] invalid for tag [{1}] according to TLD
+jsp.error.tld.unable_to_get_jar=Unable to get JAR resource [{0}] containing TLD: [{1}]
+jsp.error.tld.missing=Unable to find taglib [{0}] for URI: [{1}]
 jsp.error.tld.missing_jar=Missing JAR resource [{0}] containing TLD
 jsp.error.tld.invalid_tld_file=Invalid tld file: [{0}], see JSP specification section 7.3.1 for more details
-jsp.error.unable.to_find_method=Unable to find setter method for attribute: {0}
+jsp.error.unable.to_find_method=Unable to find setter method for attribute: [{0}]
 jsp.error.bad_tag=No tag [{0}] defined in tag library imported with prefix [{1}]
 jsp.error.xml.bad_tag=No tag [{0}] defined in tag library associated with uri [{1}] to delete generated class file [{0}]
@@ -219,75 +219,75 @@ jspc.error.fileDoesNotExist=The file arg to delete file [{0}]
 jspc.error.invalidWebXml=Aborting pre-compilation due to errors in web.xml
 jspc.error.invalidFragment=Aborting pre-compilation due to errors in web fragments
-jsp.error.library.invalid=JSP page is invalid according to library {0}: {1}
-jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: {0} error messages from TagLibraryValidator for {0} in {1}
-jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for {0}
+jsp.error.library.invalid=JSP page is invalid according to library [{0}]: [{1}]
+jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: [{0}] error messages from TagLibraryValidator for [{0}] in [{1}]
+jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for [{0}] of content reached while more parsing required: tag nesting error?
-jsp.error.parse.xml=XML parsing error on file {0}
-jsp.error.parse.xml.line=XML parsing error on file {0}: (line {1}, col {2})
-jsp.error.parse.xml.scripting.invalid.body=Body of {0} element must not contain any XML elements
-jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: {0}
-jsp.error.internal.filenotfound=Internal Error: File {0} not found
-jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: {0}
-jsp.error.unsupported.encoding=Unsupported encoding: {0}
-jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: {0} cannot be resolved in either web.xml or the jar files deployed with this application
+jsp.error.parse.xml=XML parsing error on file [{0}]
+jsp.error.parse.xml.line=XML parsing error on file [{0}]: (line [{1}], col [{2}])
+jsp.error.parse.xml.scripting.invalid.body=Body of [{0}] element must not contain any XML elements
+jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: [{0}]
+jsp.error.internal.filenotfound=Internal Error: File [{0}] not found
+jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: [{0}]
+jsp.error.unsupported.encoding=Unsupported encoding: [{0}]
+jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: [{0}] cannot be resolved in either web.xml or the jar files deployed with this application
 jsp.error.taglibDirective.uriInvalid=The URI provided for a tag library [{0}] is not a valid URI
 jsp.error.taglibDirective.missing.location=Neither 'uri' nor 'tagdir' attribute specified
 jsp.error.taglibDirective.both_uri_and_tagdir=Both 'uri' and 'tagdir' attributes specified
-jsp.error.invalid.tagdir=Tag file directory {0} does not start with "/WEB-INF/tags"
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element &lt;{0}&gt; cannot have template data. Template data must be encapsulated within a &lt;jsp:cdata&gt; element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: {1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.needAlternateJavaEncoding=Default java encoding {0} is invalid on your java platform. An alternate can be specified via the ''javaEncoding'' parameter of JspServlet.
+jsp.error.invalid.tagdir=Tag file directory [{0}] does not start with "/WEB-INF/tags"
+#jspx.error.templateDataNotInJspCdata=Validation Error: Element &lt;{0}&gt; cannot have template data. Template data must be encapsulated within a &lt;jsp:cdata&gt; element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: [{1}]
+#Error while processing taglib jar file [{0}]: [{1}]
+jsp.error.needAlternateJavaEncoding=Default java encoding [{0}] is invalid on your java platform. An alternate can be specified via the ''javaEncoding'' parameter of JspServlet.
 #Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number=An error occurred at line: {0} in the jsp file: {1}
+jsp.error.single.line.number=An error occurred at line: [{0}] in the jsp file: [{1}] error occurred at line: [{0}] in the generated java file: [{1}]
-jsp.error.location=line: {0}, column: {1}
+jsp.error.location=line: [{0}], column: [{1}]
 jsp.error.corresponding.servlet=Generated servlet error:\n
-jsp.error.jspbody.required=Must use jsp:body to specify tag body for {0} if jsp:attribute is used.
-jsp.error.jspbody.emptybody.only=The {0} tag can only have jsp:attribute in its body.
+jsp.error.jspbody.required=Must use jsp:body to specify tag body for [{0}] if jsp:attribute is used.
+jsp.error.jspbody.emptybody.only=The [{0}] tag can only have jsp:attribute in its body. elements ( &lt;%!, &lt;jsp:declaration, &lt;%=, &lt;jsp:expression, &lt;%, &lt;jsp:scriptlet ) are disallowed here.
-jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD.  Tag Library: {0}, Function: {1} function name {0} in tag library {1}
-jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function signature in TLD.  Parenthesis ''('' expected.  Tag Library: {0}, Function: {1}.
-jsp.error.tld.mandatory.element.missing=Mandatory TLD element {0} missing or empty in TLD {1}
-jsp.error.dynamic.attributes.not.implemented=The {0} tag declares that it accepts dynamic attributes but does not implement the required interface
+jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD.  Tag Library: [{0}], Function: [{1}] function name [{0}] in tag library [{1}]
+jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function signature in TLD.  Parenthesis ''('' expected.  Tag Library: [{0}], Function: [{1}].
+jsp.error.tld.mandatory.element.missing=Mandatory TLD element [{0}] missing or empty in TLD [{1}]
+jsp.error.dynamic.attributes.not.implemented=The [{0}] tag declares that it accepts dynamic attributes but does not implement the required interface
 jsp.error.attribute.noequal=equal symbol expected
 jsp.error.attribute.noquote=quote symbol expected
 jsp.error.attribute.unterminated=attribute value for [{0}] is not properly terminated
-jsp.error.attribute.noescape=Attribute value {0} is quoted with {1} which must be escaped when used within the value
+jsp.error.attribute.noescape=Attribute value [{0}] is quoted with [{1}] which must be escaped when used within the value
 jsp.error.attribute.nowhitespace=The JSP specification requires that an attribute name is preceded by whitespace
 jsp.error.attribute.duplicate=Attribute qualified names must be unique within an element
-jsp.error.missing.tagInfo=TagInfo object for {0} is missing from TLD
+jsp.error.missing.tagInfo=TagInfo object for [{0}] is missing from TLD
 jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true'
 jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true'
 jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true'
 jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type' attributes.  If 'fragment' is present, 'type' is fixed as 'javax.servlet.jsp.tagext.JspFragment'
 jsp.error.var_and_varReader=Only one of 'var' or 'varReader' may be specified
 jsp.error.missing_var_or_varReader=Missing 'var' or 'varReader' attribute
-jsp.warning.bad.urlpattern.propertygroup=Bad value {0} in the url-pattern subelement in web.xml
-jsp.error.literal_with_void=A literal value was specified for attribute {0} that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case
-jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute {0}.
-jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute {0}.
+jsp.warning.bad.urlpattern.propertygroup=Bad value [{0}] in the url-pattern subelement in web.xml
+jsp.error.literal_with_void=A literal value was specified for attribute [{0}] that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case
+jsp.error.unknown_attribute_type=Unknown attribute type [{1}] for attribute [{0}].
+jsp.error.coerce_to_type=Cannot coerce value [{2}] to type [{1}] for attribute [{0}]. XML-style 'name' attribute missing
 jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries. attribute {0} specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute{0} not allowed in a template text body. attribute [{0}] specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute[{0}] not allowed in a template text body.
 jsp.error.badStandardAction=Invalid standard action
-jsp.error.xml.badStandardAction=Invalid standard action: {0}
+jsp.error.xml.badStandardAction=Invalid standard action: [{0}]
 jsp.error.tagdirective.badbodycontent=Invalid body-content [{0}] in tag directive
-jsp.error.simpletag.badbodycontent=The TLD for the class {0} specifies an invalid body-content (JSP) for a SimpleTag.
+jsp.error.simpletag.badbodycontent=The TLD for the class [{0}] specifies an invalid body-content (JSP) for a SimpleTag.
 jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group [{0}] is different from that specified in page directive [{1}]
 jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in page directive [{1}]
 jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog [{0}] is different from that specified in jsp-property-group [{1}]
-jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute {0} does not accept any expressions
-jsp.error.attribute.standard.non_rt_with_expr=The {0} attribute of the {1} standard action does not accept any expressions
+jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute [{0}] does not accept any expressions
+jsp.error.attribute.standard.non_rt_with_expr=The [{0}] attribute of the [{1}] standard action does not accept any expressions
 jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same attribute value
-jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute {0}
-jasper.error.emptybodycontent.nonempty=According to TLD, tag {0} must be empty, but is not
-jsp.error.tagfile.nameNotUnique=The value of {0} and the value of {1} in line {2} are the same.
+jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute [{0}]
+jasper.error.emptybodycontent.nonempty=According to TLD, tag [{0}] must be empty, but is not
+jsp.error.tagfile.nameNotUnique=The value of [{0}] and the value of [{1}] in line [{2}] are the same.
 jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name attribute with a value [{0}], the value of this name-from-attribute attribute.
-jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line {1} and whose name attribute is [{0}], the value of this name-from-attribute attribute) must be of type java.lang.String, is "required" and not a "rtexprvalue".
+jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line [{1}] and whose name attribute is [{0}], the value of this name-from-attribute attribute) must be of type java.lang.String, is "required" and not a "rtexprvalue". access session scope in page that does not participate in any session
 jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions
 jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding [{0}] is not supported.
@@ -299,16 +299,16 @@ jsp.error.xml.versionInfoRequired = The
 jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with "?>".
 jsp.error.xml.reservedPITarget = The processing instruction target matching "[xX][mM][lL]" is not allowed.
 jsp.error.xml.spaceRequiredInPI = White space is required between the processing instruction target and data.
-jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x{0}) was found in the element content of the document.
+jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x[{0}]) was found in the element content of the document.
 jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before the encoding pseudo attribute in the XML declaration.
 jsp.error.xml.sdDeclInvalid = The standalone document declaration value must be "yes" or "no", not [{0}].
-jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x{0}) was found in the processing instruction.
+jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x[{0}]) was found in the processing instruction.
 jsp.error.xml.versionNotSupported = XML version [{0}] is not supported, only XML 1.0 is supported.
 jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected.
-jsp.error.xml.expectedByte = Expected byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.invalidByte = Invalid byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.operationNotSupported = Operation [{0}] not supported by {1} reader.
-jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x{0}.
+jsp.error.xml.expectedByte = Expected byte [{0}] of [{1}]-byte UTF-8 sequence.
+jsp.error.xml.invalidByte = Invalid byte [{0}] of [{1}]-byte UTF-8 sequence.
+jsp.error.xml.operationNotSupported = Operation [{0}] not supported by [{1}] reader.
+jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x[{0}].
 jsp.error.xml.invalidASCII = Byte [{0}] not 7-bit ASCII.
 jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required before the encoding pseudo attribute in the XML declaration.
 jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required before the encoding pseudo attribute in the text declaration.
@@ -318,21 +318,21 @@ jsp.error.xml.eqRequiredInXMLDecl = The
 jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow [{0}] in the text declaration.
 jsp.error.xml.quoteRequiredInTextDecl = The value following [{0}] in the text declaration must be a quoted string.
 jsp.error.xml.quoteRequiredInXMLDecl = The value following [{0}] in the XML declaration must be a quoted string.
-jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x{0}) was found in the text declaration.
-jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x{0}) was found in the XML declaration.
+jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x[{0}]) was found in the text declaration.
+jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x[{0}]) was found in the XML declaration.
 jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value following [{0}] in the text declaration is missing.
 jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value following [{0}] in the XML declaration is missing.
 jsp.error.multiple.jsp = Cannot have multiple specifications of
-jsp.error.jspoutput.conflict=&lt;jsp:output&gt;: illegal to have multiple occurrences of [{0}] with different values (old: {1}, new: {2})
+jsp.error.jspoutput.conflict=&lt;jsp:output&gt;: illegal to have multiple occurrences of [{0}] with different values (old: [{1}], new: [{2}])
 jsp.error.jspoutput.doctypenamesystem=&lt;jsp:output&gt;: 'doctype-root-element' and 'doctype-system' attributes must appear together
 jsp.error.jspoutput.doctypepublicsystem=&lt;jsp:output&gt;: 'doctype-system' attribute must appear if 'doctype-public' attribute appears
 jsp.error.jspoutput.nonemptybody=&lt;jsp:output&gt; must not have a body
 jsp.error.jspoutput.invalidUse=&lt;jsp:output&gt; must not be used in standard syntax
-jsp.error.attributes.not.allowed = {0} must not have any attributes
-jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path {0}
-jsp.error.tagfile.illegalPath=Illegal tag file path: {0}, must start with "/WEB-INF/tags" or "/META-INF/tags"
+jsp.error.attributes.not.allowed = [{0}] must not have any attributes
+jsp.error.tagfile.badSuffix=Missing ".tag" suffix in tag file path [{0}]
+jsp.error.tagfile.illegalPath=Illegal tag file path: [{0}], must start with "/WEB-INF/tags" or "/META-INF/tags"
 jsp.error.tagfile.missingPath=Path not specified to tag file
-jsp.error.plugin.wrongRootElement=Name of root element in {0} different from {1}
+jsp.error.plugin.wrongRootElement=Name of root element in [{0}] different from [{1}]
 jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not correspond to any imported tag library
 jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action
 jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action
@@ -342,35 +342,35 @@ jsp.error.variable.alias=Both or none of
 jsp.error.attribute.null_name=Null attribute name
 jsp.error.jsptext.badcontent='&lt;', when appears in the body of &lt;jsp:text&gt;, must be encapsulated within a CDATA
 jsp.error.jsproot.version.invalid=Invalid version number: [{0}], must be "1.2", "2.0", "2.1", "2.2" or "2.3"
-jsp.error.noFunction=The function {0} cannot be located with the specified prefix
+jsp.error.noFunction=The function [{0}] cannot be located with the specified prefix
 jsp.error.noFunctionMethod=Method [{0}] for function [{1}] not found in class [{2}]
-jsp.error.function.classnotfound=The class {0} specified in TLD for the function {1} cannot be found: {2}
-jsp.error.signature.classnotfound=The class {0} specified in the method signature in TLD for the function {1} cannot be found. {2}
+jsp.error.function.classnotfound=The class [{0}] specified in TLD for the function [{1}] cannot be found: [{2}]
+jsp.error.signature.classnotfound=The class [{0}] specified in the method signature in TLD for the function [{1}] cannot be found. [{2}]
 jsp.error.text.has_subelement=&lt;jsp:text&gt; must not have any subelements reading file [{0}] processing file [{0}]
-jsp.error.prefix.refined=Attempt to redefine the prefix {0} to {1}, when it was already defined as {2} in the current scope.
+jsp.error.prefix.refined=Attempt to redefine the prefix [{0}] to [{1}], when it was already defined as [{2}] in the current scope.
 jsp.error.nested_jsproot=Nested &lt;jsp:root&gt;
 jsp.error.unbalanced.endtag=The end tag "&lt;/{0}" is unbalanced
-jsp.error.invalid.bean=The value for the useBean class attribute {0} is invalid.
-jsp.error.prefix.use_before_dcl=The prefix {0} specified in this tag directive has been previously used by an action in file {1} line {2}.
+jsp.error.invalid.bean=The value for the useBean class attribute [{0}] is invalid.
+jsp.error.prefix.use_before_dcl=The prefix [{0}] specified in this tag directive has been previously used by an action in file [{1}] line [{2}].
 jsp.error.lastModified=Unable to determine last modified date for file [{0}] setting for [{0}] of [{1}] because a SecurityManager was enabled
-jsp.exception=An exception occurred processing JSP page {0} at line {1}
+jsp.exception=An exception occurred processing JSP page [{0}] at line [{1}]
 # JSP 2.1
 jsp.error.el.template.deferred=#{...} is not allowed in template text
-jsp.error.el.parse={0} : {1}
+jsp.error.el.parse=[{0}] : [{1}] directive: invalid value for deferredSyntaxAllowedAsLiteral
 jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of ''deferredSyntaxAllowedAsLiteral'' with different values (old: [{0}], new: [{1}]) directive: invalid value for trimDirectiveWhitespaces
 jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: {0}, new: {1}) directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}])
+jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of ''trimDirectiveWhitespaces'' with different values (old: [{0}], new: [{1}])
 # JSP Servlet
 jsp.error.servlet.invalid.method=JSPs only permit GET POST or HEAD
@@ -386,12 +386,12 @@ jsp.error.bug48498=Unable to display JSP
 jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was found. Attribute qualified names must be unique within an element.
 # JSP unloading handling
-jsp.message.jsp_queue_created=Created jsp queue with length {0} for context [{1}]
+jsp.message.jsp_queue_created=Created jsp queue with length [{0}] for context [{1}]
 jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}]
 jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context [{1}]
 jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue of context [{1}]
-jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after {2} seconds");
-jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: {1} queue length: {2}
+jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after [{2}] seconds");
+jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: [{1}] queue length: [{2}]
 xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream
@@ -412,6 +412,6 @@ org.apache.jasper.compiler.ELParser.inva
 org.apache.jasper.compiler.TldCache.servletContextNull=The provided ServletContext was null
 org.apache.jasper.servlet.JasperInitializer.onStartup=Initializing Jasper for context [{0}]
-org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI {1} from resource path {0} as it has already been defined in <jsp-config>
-org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI {1} from resource path {0}
+org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI [{1}] from resource path [{0}] as it has already been defined in <jsp-config>
+org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI [{1}] from resource path [{0}]
 org.apache.jasper.servlet.TldScanner.webxmlFailPathDoesNotExist=Failed to process TLD with path [{0}] and URI [{1}]. The specified path does not exist.

To unsubscribe, e-mail: [hidden email]
For additional commands, e-mail: [hidden email]
